1. Write the order of the FIRST 10 amino acids in this protein 2· F-r each of th
ID: 186543 • Letter: 1
Question
1. Write the order of the FIRST 10 amino acids in this protein 2· F-r each of the LAST 10 amino acids,tell one other amino acid that it would favorably ract with (i.e. could form a bond with). 3. In sickle cell anemia, the first glutamate (E) is mutated to valine (V). hypothesis on how this change of amino acid will affect the folding of the hemoglobin protein and why the hemoglobin function will change. Use your knowledge of the properties of side chains and non-covalent chemical interactions. Propose a THIS IS THE ONE LETTER SEQENCE OF THE AMINO ACIDS IN HEMOGLOBIN: MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTORFFESFGDLSTPDAVMGNP KVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFG KEFTPPVOAAYQKVVAGVANALAHKYHExplanation / Answer
1. The answer is
As the first nucleotide is starts from Methionine, the first ten amino acids in this proteins is
MVHLTPEEKS
Methionine-Valine-Histidine-Leucine-Theronine-Proline-Glutamate-Glutamate-Lysine-Serine.
Related Questions
Hire Me For All Your Tutoring Needs
Integrity-first tutoring: clear explanations, guidance, and feedback.
Navigate
Integrity-first tutoring: explanations and feedback only — we do not complete graded work. Learn more.