Course Contents »... »Homework 3 4 (4 pts) The peptide TSQEDRVILPDNKHNHYEDENDKSG
ID: 191900 • Letter: C
Question
Course Contents »... »Homework 3 4 (4 pts) The peptide TSQEDRVILPDNKHNHYEDENDKSGHPLWCAAL will yield: O 4 fragments with trypsin, 3 with chymotrypsin, none with cyanogen bromide. O 4 fragments with chymotrypsin, 3 with trypsin, 2 with cyanogen bromide O 2 fragments with trypsin, 3 with chymotrypsin, none with cyanogen bromide. O No fragments with trypsin, 2 with chymotrypsin, three with cyanogen bromide. O 3 fragments with cyanogen bromide, 4 with trypsin, none with chymotrypsin Submit Answer Tries 0/99 Post DiscussionExplanation / Answer
the correct answer would be the first one i.e 4 with trypsin and 3 with chymotrypsin
Chymotrypsin is site specific and will only cleave the carboxyl side of large hydrophobic or aromatic amino acids such as phenylalanine (Phe), methionine (Met), tyrosine (Tyr), and tryptophan (Trp), unless the next amino acid is proline (Pro).
Trypsin cleaves peptide chains mainly at the carboxyl side of the amino acids lysine or arginine, except when either is followed by proline.
Related Questions
Hire Me For All Your Tutoring Needs
Integrity-first tutoring: clear explanations, guidance, and feedback.
Drop an Email at
drjack9650@gmail.com
drjack9650@gmail.com
Navigate
Integrity-first tutoring: explanations and feedback only — we do not complete graded work. Learn more.