Step 2: 1.) Go to http://www.ncbi.nlm.nih.gov/BLAST/ and choose Protein BLAST un
ID: 279941 • Letter: S
Question
Step 2: 1.) Go to http://www.ncbi.nlm.nih.gov/BLAST/ and choose Protein BLAST under the Basic BLAST heading. 2.) Enter the one-letter abbreviations for your amino acid sequence in the SEARCH box labeled Enter Query Sequence - be sure to enter them in the correct order! 3.) Scroll down to the bottom of the page and click on the "BLAST" button. 4.) It may take a few minutes to process your sequence. BLAST is running an algorithm which aligns your input sequence with known sequences stored in databases. It will return a table of database sequences which represent the best matches. 5.) At the next page, scroll down to the list of proteins that matched your sequence. They are sorted so that the best matches are at the 6.) The protein our sequence encodes is (should be at the top of the list provided): 7.) Now search www.google.com to find the disease for which your protein is involved. 8.) This protein is involved in the following disease: 9.) In a couple of sentences, explain how this protein can cause disease.Explanation / Answer
2. Query sequence -
MAEAFIQVLLDNLTFFIQGELGLVFGFEKEFKKLSSMFSMIQAVLEDAQEKQLKYKAIKNWLQKLNVAAY
EVDDILDDCKTEAARFKQAVLGRYHPRTITFCYKVGKRMKEMMEKLDAIAEERRNFHLDERIIERQAARR
6. Protein - Query sequence above belong to Rb protein from Solanum cardiophyllum or Solanum polyadenium.
8. Diseases -
This protein is involved in some cancers.
9. Rb or Retinoblastoma is an tumour suppressor protein and controls the gene expression generally. But when it is modified or become non functional then cancer is developed.
Related Questions
Hire Me For All Your Tutoring Needs
Integrity-first tutoring: clear explanations, guidance, and feedback.
Drop an Email at
drjack9650@gmail.com
drjack9650@gmail.com
Navigate
Integrity-first tutoring: explanations and feedback only — we do not complete graded work. Learn more.