Academic Integrity: tutoring, explanations, and feedback — we don’t complete graded work or submit on a student’s behalf.

Consider the peptide; NH2-GAPAGPAGTGKTETTKDLAKSMALLCWFNCS-COOH Table I. pK value

ID: 142421 • Letter: C

Question

Consider the peptide; NH2-GAPAGPAGTGKTETTKDLAKSMALLCWFNCS-COOH Table I. pK values of some amino acids amino acid Alanine (Ala or A) Arginine (Arg or R) Asparagine (Asn or N) Aspartic acid (Asp or D) Cysteine (Cys or C) Glutamic acid (Glu or E) Glycine (Gly or G) Histidine (His or H) Leucine (Leu or L) Lysine (Lys or K) Phenylalanine (Phe or F) Serine (Ser or S) Tryptophan (Trp or W Tyrosine (Tyr or Y) Valine (Val or V) peptide N terminus peptide C terminus pK of side chain or terminal group uncharged 12.5 uncharged 3.9 8.3 4.3 uncharged 6.0 uncharged 10.8 uncharged uncharged uncharged 10.9 uncharged 7.8 3.6 Using Table I above, determine the net charge of the peptide at pH6 1 You are correct. Your receipt no. is 152-6557 Previous Tries Determine the net charge of the peptide at pH7. 1 You are correct. Your receipt no. is 152-2566 (f) Previous Tries Determine the net charge of the peptide at pH9 2

Explanation / Answer

ANSWER:

(1)The net charge of the given peptide GAPAGPAGTGKTETTKDLAKSMALLCWFNCS at pH 6 is +1

(2)The net charge of the given peptide GAPAGPAGTGKTETTKDLAKSMALLCWFNCS at pH 7 is +1

(3)The net charge of the given peptide GAPAGPAGTGKTETTKDLAKSMALLCWFNCS at pH 9 is -1

Hire Me For All Your Tutoring Needs
Integrity-first tutoring: clear explanations, guidance, and feedback.
Drop an Email at
drjack9650@gmail.com
Chat Now And Get Quote