Academic Integrity: tutoring, explanations, and feedback — we don’t complete graded work or submit on a student’s behalf.

Hallamase is separately digested with V8 protease and cleaved with cyanogen brom

ID: 17153 • Letter: H

Question

Hallamase is separately digested with V8 protease and cleaved with cyanogen bromide and the following peptides are obtained after each treatment:

V8 protease                                 Cyanogen bromide

ISE                                             TVQRSTKEAF
D                                                VRYCCWDISEDGTPM
TSIVGMVPAE                                      TSIVGM
WAMVRYCCWD                                 VPAEWAM
AF
GTPMTVQRSTKE

Q. Deduce the sequence of hallamase from the above data

Explanation / Answer

TSIVGMVPAEWAMVRYCCWDISEDGTPMTVQRSTKEAF