Academic Integrity: tutoring, explanations, and feedback — we don’t complete graded work or submit on a student’s behalf.

Biology and Genetics

101624 questions • Page 1886 / 2033

b) What is the case of the athletes pain and how has it results in eleveated mac
b) What is the case of the athletes pain and how has it results in eleveated macrophage activity c)How might the hip implant the runnre receieved been modified to avoin this probl…
b) c) Apoenhl a) Coenzyme 17. ifglucose is radio-labeled with ?? at C3 and C5. w
b) c) Apoenhl a) Coenzyme 17. ifglucose is radio-labeled with ?? at C3 and C5. what % ofpyruvate from glycolysis will be radioactive? d)75% e) 100% b) 25% c)50% Figure I for 18 to…
b) describe the trends/ relationship observed in the cladogram below of 5 mammal
b) describe the trends/ relationship observed in the cladogram below of 5 mammals species based genetic data c) what is the biological interpretation of both cladograms above? whi…
b) encouraging the child to ambulate as soon as possible by using a favorite pus
b) encouraging the child to ambulate as soon as possible by using a favorite push e) forcing fluids to at least 250 ml/day by oflering his favorite juices d) preventing the child …
b) initiation (including abortive initiation), the slowest step; elongation, the
b) initiation (including abortive initiation), the slowest step; elongation, the fastest step but punctuated by pauses; and termination, requiring stalling and subsequent dissocia…
b) red hot thumbtack to the warm water. c) no heat flow d) not enough informatio
b) red hot thumbtack to the warm water. c) no heat flow d) not enough information. 44. When stringing telephone lines between poles in the summer, it is advisable to allow the lin…
b) skin d Blood e) Scalp Which of the following dis 41) eyes:of the 8 diseases i
b) skin d Blood e) Scalp Which of the following dis 41) eyes:of the 8 diseases is 1ikely to be passed on from the mntes vo n a) syphilis b) Gonorrhea c) Herpes d) Aids CMV (Cytome…
b).paacanendt... prooic amino actd residues womin 22) consider the following two
b).paacanendt... prooic amino actd residues womin 22) consider the following two peptides i LKAENDEAARAMSEA i) CRAd6FwDaPGTSN a) Which of the above peptides will likely form an a-…
b)The TAPETUM, which is part of the Anther, has 2 functions. One function is tha
b)The TAPETUM, which is part of the Anther, has 2 functions. One function is that it synthesizes proteins that are layed down in the wall of the pollen grain. These proteins funct…
b, reaction formation 4. Four-year-old Brandon h e et al, 2002). The study surve
b, reaction formation 4. Four-year-old Brandon h e et al, 2002). The study surveyed workers in of employees of IBM, a multinational corpora list Geert Hofstede conducted a lawn. T…
b- Externalinternal Imac veins e- Descending Aorta 11- Which are the blood vesse
b- Externalinternal Imac veins e- Descending Aorta 11- Which are the blood vessels that have internal valves: a- Arteries b- Lymphatic. c-Ducts. d- Veins. e- Capillaries. 12- The …
b- Septicemia c- Viremia d- Toxemia 6- True or false Adhesion proteins found on
b- Septicemia c- Viremia d- Toxemia 6- True or false Adhesion proteins found on the tip of the pili are responsible for attachment of pathogen to host. 7- Shigella can penetrate t…
b-Substances transported by facilitated diffusion 1. move passively via help fro
b-Substances transported by facilitated diffusion 1. move passively via help from carrier proteins from an area of greater concentration to one of lower concentration. 2. are limi…
b. (6pts) A diseased tissue is removed from a patient in surgery. The patient ha
b. (6pts) A diseased tissue is removed from a patient in surgery. The patient has been extremely ill with something physicians cannot diagnose. The have asked you, the pathologist…
b. 0.75 mL O c. 0.3 ml. d. 0.5 mL Question 29 The Patient has fentanyl citrate 8
b. 0.75 mL O c. 0.3 ml. d. 0.5 mL Question 29 The Patient has fentanyl citrate 80 mcg IM ordered a2 h nurse administer? pm for pain. How many milliters will the answered Marked ou…
b. 1 ml 1ml -I Final dilution 4(1 point) This represents a serial dilution to de
b. 1 ml 1ml -I Final dilution 4(1 point) This represents a serial dilution to determine viable bacterial counts. Indicate the final dilutions in each of the two tubes. Note that t…
b. 10% c. 18% d. 30% 41. The AGo for hydrolysis of ATP to ADP and P, is a. +14 k
b. 10% c. 18% d. 30% 41. The AGo for hydrolysis of ATP to ADP and P, is a. +14 kcal/mole d.-0.5 42. The hydrolysis of ATP to ADP and phosphate allows glucose-6-phosphate to be syn…
b. A 35 year old female with AIDS is brought into the Emergency Department with
b. A 35 year old female with AIDS is brought into the Emergency Department with a fever of 39oC ad a three month history of copious diarrhea. On physical exam, the patient is a th…
b. A coastal city has only two major sources of sulfur, rain derived from the oc
b. A coastal city has only two major sources of sulfur, rain derived from the ocean and sulfur derived from a coal-burning power plant. A sample of city air yields ?34S = +14.0 2.…
b. A patient sustained an injury to the lower motor neurons when a board fell on
b. A patient sustained an injury to the lower motor neurons when a board fell on his back at a construction site. The upper motor neurons are intact and undamaged. Determine the e…
b. A sequencing reaction has a ratio of 300 molecules of dATP\'s to 1 molecule o
b. A sequencing reaction has a ratio of 300 molecules of dATP's to 1 molecule of ddATP. What is the probability that termination will occur for a given position in the growing str…
b. Assume K+ movement is balanced by the movement of an anion, Cl-. Cl- enters a
b. Assume K+ movement is balanced by the movement of an anion, Cl-. Cl- enters a plant cell (channel, pump, an electrochemical gradient. A likely transport protein is a antiport, …
b. Autonomy c. Justice d. Fidelity critically ill patient out of the ICU so that
b. Autonomy c. Justice d. Fidelity critically ill patient out of the ICU so that a 5. The health care team responsible for deciding whether to move a new patient a. Veracity b. Ju…
b. Bile salts are modified from which molecule? Answer: c. What is the function
b. Bile salts are modified from which molecule? Answer: c. What is the function of bile? Answer: d. Write out the enterohepatic circulation pathway to recycle bile salts. Answer: …
b. C. d. prophyte depéndent on gametophyte Gametophyte dependent on sporophyte I
b. C. d. prophyte depéndent on gametophyte Gametophyte dependent on sporophyte Independent sporophyte and gametophyte Sporophyte dominance Question 3 (1 point) The figure at right…
b. Can a drug or biologic approved for a specific indication be used for a diffe
b. Can a drug or biologic approved for a specific indication be used for a different indication by a US-licensed Physician in the US? Explain your response and include the followi…
b. Change in membrane C? Spontaneous change in C. The myelin sheath around PNS m
b. Change in membrane C? Spontaneous change in C. The myelin sheath around PNS membrane permeability 18 Which of the following is TRUE ofa 14 What ope of membrane channels open an…
b. Chr c. Cyt oskelet on d. Oyt oplasm 2. Rrx Rr a. What are the different kinds
b. Chr c. Cyt oskelet on d. Oyt oplasm 2. Rrx Rr a. What are the different kinds of gametes these parents can produce? Make a punnett square c. Wha t percentage of the offspring w…
b. Drosophila melanogaster c. Xenopus laevis d. Yeast 18. Arabidopsis thaliana i
b. Drosophila melanogaster c. Xenopus laevis d. Yeast 18. Arabidopsis thaliana is a model organism for studying the molecular biology of a. fungi c. fruit flies. d. vertebrates. 1…
b. Endoparasite Whe c. Ovipositionenitu d. Hemolymph-D-List Aud e. Hemocyte i t.
b. Endoparasite Whe c. Ovipositionenitu d. Hemolymph-D-List Aud e. Hemocyte i t. Apoptosis Let sare aung with ess 2. What type of virus exists in the wasp and where does it specif…
b. Every so often, the Sun produces massive solar flares that could have an effe
b. Every so often, the Sun produces massive solar flares that could have an effect on Earth. We are not going to cover this type of an event in this course, nevertheless it is som…
b. False codon and the first occurs between the third position in the position i
b. False codon and the first occurs between the third position in the position in the anticodon. a. Wobble pairing b. Watson-Crick Base pairing C. Both d. None of the Above 3. Whi…
b. Figure 1, located at the end of this document, shows Historic Earthquake Seis
b. Figure 1, located at the end of this document, shows Historic Earthquake Seismicity along a portion of the Mariana Trench. You should note that not all the earthquakes occur at…
b. Find the answer to this question online: What percent of DNA does the Asian e
b. Find the answer to this question online: What percent of DNA does the Asian elephant and the wooly mammoth share? Please cite your source. c. Explain this statement: "The genom…
b. Flower color in this species is controlled by two factors: (1) genes and (2)
b. Flower color in this species is controlled by two factors: (1) genes and (2) the pH of the soil in which the plant grows. A genetic analysis shows that 30% of the variation in …
b. From these data compute the value of the \"true\" Vmax and the values of the
b. From these data compute the value of the "true" Vmax and the values of the various Michaelis constants for your mechanism, i.e. Ka, Kb, and Kab. ii. Does this mechanism fit wit…
b. How many cats have the heterozy gous (LI) genotype? 4. In humans, the gene fo
b. How many cats have the heterozy gous (LI) genotype? 4. In humans, the gene for sickle-cell trait has two alleles, A and a. People with the aa genotype have the blood disease si…
b. How many picograms of DNA are there at the start of prophase? c. How many chr
b. How many picograms of DNA are there at the start of prophase? c. How many chromosomes are there at metaphase? 1-1 hro inos,en d. How many chromatids are there at prophase?chrom…
b. How many sister chromatids are present in a cell during prophase?b c. How man
b. How many sister chromatids are present in a cell during prophase?b c. How many chromosomes are present during metaphase Il of meiosis?- d. How many sister chromatids are presen…
b. If [glucose] is greater outside the muscle cell than inside, what is the sign
b. If [glucose] is greater outside the muscle cell than inside, what is the sign of AG for transport of the c. What is the value of Keg for the movement of glucose across the plas…
b. If this is a sulfide ore, what is the mineral of interest? (1) c. What is the
b. If this is a sulfide ore, what is the mineral of interest? (1) c. What is the assay of the ore? (1) d. If a separation were done on the ore only at a specific gravity of 2.80, …
b. If we assume that a lagging strand fragment is made from region 1, what will
b. If we assume that a lagging strand fragment is made from region 1, what will be its sequence? How Do I know the sequence of the lagging strand? Answer key attached: Please expl…
b. Label which set of bands is the result of the amplifica- tion by the unc18 pr
b. Label which set of bands is the result of the amplifica- tion by the unc18 primers and which by the GLUT4 primers. Why was RT-PCR with GLUT4 primers used as the positive contro…
b. List the species of the sequences in the file. 10 233 sp|P24894|MNNFFQGYNLLFQ
b. List the species of the sequences in the file. 10 233 sp|P24894|MNNFFQGYNLLFQHSLFASYMDWFHSFN-CSLLLGVLV-FVTLLFGYLIF sp|P00403|---MAHAAQVGLQDATS-PIMEELITFHDHALMIIFLICFLVLYALFLTL …
b. Mucous Membrane C Serous Membrane Cutaneous Membrane 17. Renin plays a role i
b. Mucous Membrane C Serous Membrane Cutaneous Membrane 17. Renin plays a role in the conversion of: a Angiotensin I to Angiotensin lI b. Angiotensinogen to Angiotensin I c. Angio…
b. Nerves C. Skin d. Lung epithelium e. Heart During fertilization in invertebra
b. Nerves C. Skin d. Lung epithelium e. Heart During fertilization in invertebrates, what is the earliest event to occur in the process? a. Sperm contacts the cortical granules ar…
b. Pharmacogenomics C CRISPR-Cas d. Genomics LO 13.1 to LO 13.4 19. As an employ
b. Pharmacogenomics C CRISPR-Cas d. Genomics LO 13.1 to LO 13.4 19. As an employee working in a job with health care ys for your care? eMplor 20. Who pays for the health care of t…
b. Shown below is part of Figure 3 of the paper by Ferreira et al. 2007 (Molecul
b. Shown below is part of Figure 3 of the paper by Ferreira et al. 2007 (Molecular and Cellular Biology, 27:4037-4048). In this paper the authors assemble nucleosomes from a 181 b…
b. The air parcel will continue traveling towards the east at 5 m/s C. The air p
b. The air parcel will continue traveling towards the east at 5 m/s C. The air parcel will travel towards the west at 5 m/s 3. Which of the following is FALSE? The pressure gradie…
b. This ion is largely responsible for maintaining the negative membrane potenti
b. This ion is largely responsible for maintaining the negative membrane potential (- 65 mV) of the resting neuron. This ion reaches its equilibrium (same number of ions leaving t…