Cell biology help The primary sequence (in one-letter symbol) of a protein is gi

Question

Cell biology help

The primary sequence (in one-letter symbol) of a protein is given below. The N-terminal & C-terminal regions are highlighted in blue. Based on your understanding about various types of signaling sequences that direct proteins to their destinations, determine where this protein will be translocated to and WHY? What does normally happen to the signaling sequence after the protein is properly translocated to its destination? Explain your answer. [Hint: Refer to Fig. 4.3 of Chapter 4 or lecture note 4 for amino acid symbols and side chain properties]

*H3NMRSSATLLSRVAVLGAAGGIGQPLSLLLKCSPLVTDLSLYDIRGGTGVAADLFHIPSPAEVTGFASDELEK AVK GADLVLVAAGlPRKPGMTRDIDLFNTNAGIVRDLVTAVARAAPKAIIGVISNPVNSTVPVAAETLKKLGAY DPGRL FGVTTLDVVRARTFVAEALGRSPYDIDVPVVGGHSGETIVPLLSGFPSLSKEQVEQLTYRIQFGGDEVV KAKAGKGSATLSMAYAASDWSTSILKALRGDKGIAEYAFVENDLQQPHCHIFFGCAVELGTHGVERVLPIPAL NAYEQQLLDACVPALSAIELRKGVDFAVKTHLTPDCCOOT

Explanation / Answer

1) The protein will be translocated to either Endoplasmic reticulum(in eukaryotes) or to plasma membrane ( in prokaryotes) as the signal peptide enters the cell via these two paths in both of the cell types respectively.

Related Questions

Navigate

• Browse (All)
• Browse C
• Subjects

---

---

Integrity-first tutoring: explanations and feedback only — we do not complete graded work. Learn more.