Browse A
Alphabetical listing with fast deep pagination.
167681 items • Page 3257 / 3354
a. What is the pH of a 1.08 M solution of (CH 3 CH 2 ) 2 NH that is also 0.49 M
a. What is the pH of a 1.08 M solution of (CH3CH2)2NH that is also 0.49 M in diethylammonium sulfate, the salt of it's conjugate acid? The Kb for (CH3CH2)2NH = 6.9 X 10-4. b. In o…
a. What is the pH of a 1.14 M solution of CH 3 COOH that is also 0.65 M in galli
a. What is the pH of a 1.14 M solution of CH3COOH that is also 0.65 M in gallium acetate, the salt of it's conjugate base? The Ka for CH3COOH = 1.8 X 10-5. b. In one flask you are…
a. What is the payback and discounted payback of these two projects? What are th
a. What is the payback and discounted payback of these two projects? What are the main flaws with these two models? b. What is the NPV and IRR of each Project? Based on your analy…
a. What is the population in this experiment? What is the sample? b. What basic
a. What is the population in this experiment? What is the sample? b. What basic type of study design will you use to answer the research question? a) descriptive b) experimental c…
a. What is the position of the object at t = 2 s? b. What is the position of the
a. What is the position of the object at t = 2 s? b. What is the position of the object at t = 6 s? a. What is the total displacement between t = 3 s and t = 8 s? P…
a. What is the precipitate which forms and then dissolves upon adding H_2 SO_2 t
a. What is the precipitate which forms and then dissolves upon adding H_2 SO_2 to the mixture of K^+, [Al (H_2 O)_2 (OH)_4]^- and OH^-? b. Calculate the volume of 6.0 M sulfuric a…
a. What is the present value of 4 equal annual payments of $12,000 with an annua
a. What is the present value of 4 equal annual payments of $12,000 with an annual interest rate of 5%? b. What is the present value of single payment of $20,000 to be paid in 5 ye…
a. What is the present value of nine annual cash payments of $6,000, to be paid
a. What is the present value of nine annual cash payments of $6,000, to be paid at the end of each year using an interest rate of 4%? b. What is the present value of $20,000 to be…
a. What is the probability of randomly selecting a score less than X = 51? h. Wh
a. What is the probability of randomly selecting a score less than X = 51? h. What is the probability of selecting a sample of n#: 4 scores with a mean less than M 51? c. What is …
a. What is the probability of randomly selecting a score less than X = 51? h. Wh
a. What is the probability of randomly selecting a score less than X = 51? h. What is the probability of selecting a sample of n#: 4 scores with a mean less than M 51? c. What is …
a. What is the probability of rolling a large straight (either 1-2-3-4-5 or 2-3-
a. What is the probability of rolling a large straight (either 1-2-3-4-5 or 2-3-4-5-6) on one roll of the five dice? b. Given that two 6's have been rolled, what is the probabilit…
a. What is the probability that a randomly selected exam will have a score of at
a. What is the probability that a randomly selected exam will have a score of at least 71? b. What percentage of exams will have scores between 89 and 92? c. If the top 2.5% of te…
a. What is the probability that a randomly selected exam will have a score of at
a. What is the probability that a randomly selected exam will have a score of at least 71? b. What percentage of exams will have scores between 89 and 92? c. If the top 2.5% of te…
a. What is the probability that a respondent 18-29 years of age thinks that glob
a. What is the probability that a respondent 18-29 years of age thinks that global warming will not pose a serious threat during his/her lifetime (to 4 decimals)? b. What is the p…
a. What is the probability that the sample will have between 35% and 40% who say
a. What is the probability that the sample will have between 35% and 40% who say they will consider only cars manufactured by a company in their country when purchasing a new car?…
a. What is the purpose of the Income Statement? b. What is another name for the
a. What is the purpose of the Income Statement? b. What is another name for the Balance Sheet? c. What types of activities would increase the balance of Owner’s Equity? d. How do …
a. What is the range of unsigned integer numbers that can be represented with 4
a. What is the range of unsigned integer numbers that can be represented with 4 bits 8 bits 32 bits n bits b. What is the range of numbers in signed magnitude format that can be r…
a. What is the rate law for the uncatalyzed reaction? a. \ m rate={\\it k}[Ce^{4
a. What is the rate law for the uncatalyzed reaction? a. m rate={it k}[Ce^{4+}]^2[Tl^+] b. m rate={it k}[Ce^{4+}][Tl^+] c. m rate={it k}[Ce^{4+}] d. m rate={it k}[Ce^{4+}][Tl^+]^2…
a. What is the rate law for the uncatalyzed reaction? a. \ m rate={\\it k}[Ce^{4
a. What is the rate law for the uncatalyzed reaction? a. m rate={it k}[Ce^{4+}]^2[Tl^+] b. m rate={it k}[Ce^{4+}][Tl^+] c. m rate={it k}[Ce^{4+}] d. m rate={it k}[Ce^{4+}][Tl^+]^2…
a. What is the rationale of the treatments ordered? b. What nursing care should
a. What is the rationale of the treatments ordered? b. What nursing care should be provided for the patient? Mark Penn, a 25-year-old patient, is diagnosed with psorias…
a. What is the significance of Vsop? That is, what have you learned if you measu
a. What is the significance of Vsop? That is, what have you learned if you measure Vnaop? Note: Don't say that " Vop is the potential that causes the current to stop." That is mer…
a. What is the source port for TCP, and what protocol type is using TCP fot tran
a. What is the source port for TCP, and what protocol type is using TCP fot transport? b. What is the destination port, and what does the port number indicate c. what is the ackno…
a. What is the standardly accepted percentage of sequence identity for two prote
a. What is the standardly accepted percentage of sequence identity for two proteins to be considered as probably having similar function? According to K R Acharya, R Shapiro, S C …
a. What is the theoretical pH at the stoichiometric equivalence point for the ti
a. What is the theoretical pH at the stoichiometric equivalence point for the titration of the weak acid? ACETIC ACID REACTING WITH NaOH Hint: Your volume at the stoichiometric po…
a. What is the total address space that can be covered by that mode? b. What wou
a. What is the total address space that can be covered by that mode? b. What would be the maximum size of an integer array, if the compiler would use this instruction? 2. T…
a. What is your current total revenue for both groups? b. The elasticity of dema
a. What is your current total revenue for both groups? b. The elasticity of demand is more elastic in which market? c. Which market has the more inelastic demand? d. What is the e…
a. What is/are the name(s) of the functional group(s) that contain oxygen in the
a. What is/are the name(s) of the functional group(s) that contain oxygen in the two molecules we are using in this lab (ethyl acetate and butyl acetate)? b. Define “boiling point…
a. What ishe prebability thot of the n1 1 29 cld urvcycd, exacty our wll own a t
a. What ishe prebability thot of the n1 1 29 cld urvcycd, exacty our wll own a tablet? Type an integer or a decima. Round to four deciml paces to the right cf deciml po nt a needc…
a. What lease payment will make the lessee and the lessor equally well off? (Do
a. What lease payment will make the lessee and the lessor equally well off? (Do not round intermediate calculations and round your final answers to 2 decimal places. (e.g., 32.16)…
a. What made Virgin’s strategy successful and how does it compare with that of S
a. What made Virgin’s strategy successful and how does it compare with that of Sony and Matsushita? The move by the Virgin Group into the field of airline operation, financial…
a. What mechanism best explains the patter observed in the uploaded question? b.
a. What mechanism best explains the patter observed in the uploaded question? b. What is the genotype of the Mighty Mouse? Explain. c. Mighty is placed in a cage with a female mou…
a. What must happen in order for a reaction to occur? Molecules must -be the sam
a. What must happen in order for a reaction to occur? Molecules must -be the same -attract one another -be liquid or gas -collide b. What else must happen for molecules to react? …
a. What name is given to a drug that is similar in structure to the endogenous l
a. What name is given to a drug that is similar in structure to the endogenous ligand and binds with that messenger's receptor to stimulate a cellular response? b. What name is gi…
a. What name is given to a drug that is similar in structure to the endogenous l
a. What name is given to a drug that is similar in structure to the endogenous ligand and binds with that messenger's receptor to stimulate a cellular response? b. What name is gi…
a. What output should be produced? b. What will be the price? c. How much profit
a. What output should be produced? b. What will be the price? c. How much profit is made? d. If the firm can change plant size and move into the long run, what will be output and …
a. What percentage of the sample members are nonwhite? b. Test the hypothesis th
a. What percentage of the sample members are nonwhite? b. Test the hypothesis that other things equal, people who are married earn more than people who are not, using a 5% level o…
a. What policy changes are meant by the phrase “tax reform”? b. What is an endow
a. What policy changes are meant by the phrase “tax reform”? b. What is an endowment in an exchange economy? c. Why is the endowment always on the budget constraint? d. Do you hav…
a. What statistical testshould be used to analyze the data? b. Is this a one- or
a. What statistical testshould be used to analyze the data? b. Is this a one- or two-tailed test? c. What are H0and Ha for this study? d. Find tcvfrom appendix A …
a. What type of link state update messages should be sent from router R1 to rout
a. What type of link state update messages should be sent from router R1 to router R3 about N1. Please define the type of the link state message (router link, network link, summar…
a. What type of sequence the file contain, DNA sequences or protein sequences? b
a. What type of sequence the file contain, DNA sequences or protein sequences? b. List the species of the sequences in the file. 10 233 sp|P24894|MNNFFQGYNLLFQHSLFASYMDWFHSFN-CSLL…
a. What was the independent variable in this analysis? b. What was the dependent
a. What was the independent variable in this analysis? b. What was the dependent variable in this analysis? c. Describe both samples (using the given statistics). d. What are the …
a. What were HCA\'s liabilities-to-assets ratios and times-interest-earned ratio
a. What were HCA's liabilities-to-assets ratios and times-interest-earned ratios in the years 2005 through 2009? b. What percentage decline in EBIT could HCA have suffered each ye…
a. What were the causes of the problems with the frozen food company? A company
a. What were the causes of the problems with the frozen food company? A company based in London owned a frozen food factory in north-west England. Over a period of years, the …
a. What will be the monthly payment on a 30-year, $250,000 mortgage loan, where
a. What will be the monthly payment on a 30-year, $250,000 mortgage loan, where the interest rate is 6% per year, compounded monthly? How much interest is paid over the life of th…
a. What will the last unit cost to build? (Round your answer to the nearest doll
a. What will the last unit cost to build? (Round your answer to the nearest dollar amount.) Cost of last unit $ b. What will be the average time for the 20 missile guidance contro…
a. What would be the expected change in compressive strength if a specimen was t
a. What would be the expected change in compressive strength if a specimen was tested using the same concrete mix but was larger (say 6 by 12 inch cylinder (note that the force wo…
a. What would be the worldwide effective tax rate on the $1 million of foreign p
a. What would be the worldwide effective tax rate on the $1 million of foreign profits, assuming the U.S. taxes the worldwide income of domestic corporations, but allows an unlimi…
a. What would you predict about the reactivity of potassium in hydrochloric acid
a. What would you predict about the reactivity of potassium in hydrochloric acid compared to potassium in water? b. Which atom would you expect to have the largest radius, boron o…
a. What would your recommendation be if the weights for Safety went down to 10 a
a. What would your recommendation be if the weights for Safety went down to 10 and Profitability went up to 25? b. Suppose instead that method A received a score of 3 for Safety a…
a. When the Federal Reserve makes an open market purchase, the Fed: buys securit
a. When the Federal Reserve makes an open market purchase, the Fed: buys securities from banks and the public, which will decrease the money supply. sells securities to banks and …