A transmembrane protein usually has the following features: (1) the portion that

Question

A transmembrane protein usually has the following features: (1) the portion that transits the membrane bilayer is at least 20 amino acids in length, which are largely or exclusively nonpolar residues; (2) the portion that anchors the protein on the external face has two or more consecutive acidic residues; and (3) the portion that anchors the protein on the cytoplasmic face has two or more consecutive basic residues. Consider the transmembrane protein with the following sequence: NH2-MLSTGVKRKGAVLLILLFPWMVAGGPLFWLAADESTYKGS-COOH Draw this protein as it would reside in the plasma membrane

Explanation / Answer

Okay so it would take forever to draw this out but it is not too difficult if you know what the letters stand for. Look up amino acids on a search engine and you will see that they have three letter abbreviations and one letter abbreviations for each amino acid. So for example, you will start out the protein with NH2 drawn out (which you can find online) and then connect it to the carboxyl or COOH end of the next amino acid in the sequence. For yours, it is M, which stands for methionine. If you have an amino acid that has two COOH units or two NH2 units, just connect the next amino acid to either one of those, it is not specific on which one you connect it to. Use this website as a guide to drawing all the amino acids. The black parts are the common group (what every amino acid has) and the red part are the side chains (which make each amino acid different). Hope this helps!

Related Questions

Navigate

• Browse (All)
• Browse A
• Subjects

---

---

Integrity-first tutoring: explanations and feedback only — we do not complete graded work. Learn more.