A transmembrane protein usually has the following features: (1)the portion that

Question

A transmembrane protein usually has the following features: (1)the portion that transits the membrane bilayer is at least 20 aminoacids in length, all of which are nonpolar residues; (2) theportion that anchors the protein on the external face has two ormore consecutive acidic residues; and (3) the portion that anchorsthe protein on the cytoplasmic face has two or more consecutivebasic residues. Consider the transmembrane protein with thefollowing sequence:

           NH2-MLSTGVKRKGAVLLILLFPWMVAGGPLFWLAADESTYKGS-COOH

Draw this protein as it would reside in the plasmamembrane. Make sure you label the N- and theC- termini and the external and cytoplasmic faces of themembrane.

(it mentions using amino acid code which i have access to but itdoesn't make any sense to me)

If someone could simply do this for me I would MORE than greatlyappreciate it and will gladly rate you as a LIFESAVER! Thankyou in advance

Explanation / Answer

Related Questions

Navigate

• Browse (All)
• Browse A
• Subjects

Integrity-first tutoring: explanations and feedback only — we do not complete graded work. Learn more.