Biology and Genetics
101624 questions • Page 1873 / 2033
a. What are the parental phenotypes and what are the recombinant phenotypes? b.
a. What are the parental phenotypes and what are the recombinant phenotypes? b. Calculate the distances between the 3 traits in map units. c. Draw a genetic map of these three tra…
a. What are the steps/characteristics of lysosome centered protein degradation?
a. What are the steps/characteristics of lysosome centered protein degradation? Discuss any specificities and give an example of at least one protein which is cleared via the lyso…
a. What are the steps/characteristics of lysosome centered protein degradation?
a. What are the steps/characteristics of lysosome centered protein degradation? Discuss any specificities and give an example of at least one protein which is clea…
a. What can be said about the population dynamics of these interacting species?
a. What can be said about the population dynamics of these interacting species? b. Describe the yearly fluctuations. c. What appears to be the approximate K for each species in th…
a. What chemical properties make PDMS Poly(dimethyl siloxane) suitable for long-
a. What chemical properties make PDMS Poly(dimethyl siloxane) suitable for long-term contact with the human body? b. What mechanical properties make PP Poly(propylene) ideal for u…
a. What fhas teen the main impact of DNA techoology on the a. uncetainty between
a. What fhas teen the main impact of DNA techoology on the a. uncetainty between the crime scene sample and the h priviang loopholen in lows regarding DNA testing and s not much i…
a. What inheritance pattern that best describes the pedigree? b. State the reaso
a. What inheritance pattern that best describes the pedigree? b. State the reasons you ruled out at least three other potential inheritance patterns. c. List the genotypes present…
a. What is meant by the term accumulated elements when used to refer to the elem
a. What is meant by the term accumulated elements when used to refer to the elements in seawater? b. Which elements fall into this category? H, O, Na, Mg, Ca, K, Sr, B,C, F, S, Cl…
a. What is the H+ concentration for an aqueous solution with pOH = 3.73 at 25 ?C
a. What is the H+ concentration for an aqueous solution with pOH = 3.73 at 25 ?C? Express the molar concentration numerically using two significant figures. b. Arrange the followi…
a. What is the difference between state and personal paternalism? b. What are so
a. What is the difference between state and personal paternalism? b. What are some of the health and social issues surrounding reproductive control? (What controversies exist?) c.…
a. What is the mode of inheritance for each of the two mutations that we assigne
a. What is the mode of inheritance for each of the two mutations that we assigned your team? Explain the evidence (from your figure) that warrants these conclusions. b. Are these …
a. What is the rationale of the treatments ordered? b. What nursing care should
a. What is the rationale of the treatments ordered? b. What nursing care should be provided for the patient? Mark Penn, a 25-year-old patient, is diagnosed with psorias…
a. What is the standardly accepted percentage of sequence identity for two prote
a. What is the standardly accepted percentage of sequence identity for two proteins to be considered as probably having similar function? According to K R Acharya, R Shapiro, S C …
a. What mechanism best explains the patter observed in the uploaded question? b.
a. What mechanism best explains the patter observed in the uploaded question? b. What is the genotype of the Mighty Mouse? Explain. c. Mighty is placed in a cage with a female mou…
a. What name is given to a drug that is similar in structure to the endogenous l
a. What name is given to a drug that is similar in structure to the endogenous ligand and binds with that messenger's receptor to stimulate a cellular response? b. What name is gi…
a. What name is given to a drug that is similar in structure to the endogenous l
a. What name is given to a drug that is similar in structure to the endogenous ligand and binds with that messenger's receptor to stimulate a cellular response? b. What name is gi…
a. What type of sequence the file contain, DNA sequences or protein sequences? b
a. What type of sequence the file contain, DNA sequences or protein sequences? b. List the species of the sequences in the file. 10 233 sp|P24894|MNNFFQGYNLLFQHSLFASYMDWFHSFN-CSLL…
a. When you are vigorously exercising, and your muscle cells are being powered b
a. When you are vigorously exercising, and your muscle cells are being powered by glucose supplied from the degradation of their glycogen stores, you will produce 3 ATP/glucose mo…
a. Which aicU b. What are the most probable genotyl in each cross? 6. W t tail.
a. Which aicU b. What are the most probable genotyl in each cross? 6. W t tail. Six pairs of es and those of their A mutant allele in mice causes a bent tail. SIX pa mice were cro…
a. Which letter represents the free energy of the reaction? b. What type of reac
a. Which letter represents the free energy of the reaction? b. What type of reaction is this classified as? c. What is the difference between the two reactions shown on the reacti…
a. Which of the following statement about greenhouse effect is true i. Greenhous
a. Which of the following statement about greenhouse effect is true i. Greenhouse gases can absorb more radiation energy from sunlight, thus increasing the earth’s temperature . i…
a. Which plot has the greatest species diversity as would be measured by the Sim
a. Which plot has the greatest species diversity as would be measured by the Simpson?s index of diversity, which measures species evenness? Don?t wor Plant Family Species common n…
a. Which project would you pick? b. Why do you think this project is important?
a. Which project would you pick? b. Why do you think this project is important? c. What kind of experiments would you do? e Chegg Study! Guided So ×YDS My Grades-201508-BIOL xy D …
a. Which treatment had the highest settlement of larvae? b. Which treatment(s) h
a. Which treatment had the highest settlement of larvae? b. Which treatment(s) had the lowest settlement of larvae? c. Based on figure 1a and 1b only, does the density of bacteria…
a. Why are two numbers shown for each individual? (the \"fractions\" below each
a. Why are two numbers shown for each individual? (the "fractions" below each individual and the numbers above each invidicual) b. What do you think is the relationship between th…
a. With respect to a raster data set, explain the relationship between spatial r
a. With respect to a raster data set, explain the relationship between spatial resolution, data volume, and capturing variability of a geographic feature or surface. b. Define co…
a. Would you expect virus growing in a medium containing 35S to synthesize DNA c
a. Would you expect virus growing in a medium containing 35S to synthesize DNA containing 35S? A.No B.Yes C.Yes, but only a little b. Which statement best reflects your reasoning?…
a. Write a balanced reaction for equilibrium among the magnesian endmembers pyro
a. Write a balanced reaction for equilibrium among the magnesian endmembers pyrope garnet (Mg3Al2Si3O12), spinel (MgAl2O4), forsterite (Mg2SiO4), and enstatite (MgSiO3). (Hint to …
a. Yes b. No 24. Can a lipid soluble protein readily cross the cell membrane? a.
a. Yes b. No 24. Can a lipid soluble protein readily cross the cell membrane? a. Yes b. No 25. Are the phosphate heads on the outside of the cell hydrophilic or hydrophobic? a. Hy…
a. You and your spouse have no children. You stand to inherit a sezeable fortune
a. You and your spouse have no children. You stand to inherit a sezeable fortune from your crazy Uncle Irving if you can produce three daughters in your family of three children. …
a. You decide to separate the bio- and X strain from the mix. You have spreaders
a. You decide to separate the bio- and X strain from the mix. You have spreaders, filter paper, Petri plates with agar gels supplemented with either biotin, only arginine, both or…
a. You have recently discovered a novel protein having a predicted molecular wei
a. You have recently discovered a novel protein having a predicted molecular weight of 55 kD based on the amino acid sequence and denaturing polyacrylamide gel analysis. After pur…
a. You start a culture of stem cells and you use a protocol to differentiate the
a. You start a culture of stem cells and you use a protocol to differentiate them into beta cells. To make sure they are truly beta cells. First you want to check whether the insu…
a. a bottle of concentrated aqueous sulfuric acid (98.079g/mol) labled 98% wt% H
a. a bottle of concentrated aqueous sulfuric acid (98.079g/mol) labled 98% wt% H2SO4 has aconcentration of 18.0 M NaOH. a)How many milliliters of reagentshould be diluted to 1.00 …
a. an aqueous solution of antifreeze contains 6.067 M ethyleneglycol (HOCH 2 CH
a. an aqueous solution of antifreeze contains 6.067 M ethyleneglycol (HOCH2CH2OH, 62.07 g/mol) and has adensity of 1.046 g/mL. Find the mass of 1.00L of this solution andthe numbe…
a. b. C. Time 1) In the above figure, which line best depicts an obligate anaero
a. b. C. Time 1) In the above figure, which line best depicts an obligate anaerobe in the presence of O2? A) a B) b C) c 2) Glycolysis is the breakdown of: A) protein B) amino aci…
a. b. c. d. all questions binism is a sex-linked inherited condition. Albinism r
a. b. c. d. all questions binism is a sex-linked inherited condition. Albinism results in an absence of pigment melanin in the cyes, skin, and hair. This condition is transmitted …
a. beta hemolysis b. antibiotic susceptibility test c. enteric bacteria d. pyelo
a. beta hemolysis b. antibiotic susceptibility test c. enteric bacteria d. pyelonephritis e. medical mycology Use the following link or your lab manual to answer the following que…
a. beta hemolysis b. antibiotic susceptibility test c. enteric bacteria d. pyelo
a. beta hemolysis b. antibiotic susceptibility test c. enteric bacteria d. pyelonephritis e. medical mycology Use the following link or your lab manual to answer the following que…
a. breaks at or near the centromeres of two acrocentric chromosomes b. breaks at
a. breaks at or near the centromeres of two acrocentric chromosomes b. breaks at or near the centromeres of two metacentric chromosomes c. breaks at or near the centromeres of one…
a. cDNA 1) proteomics b. phylogenetic conservation 2) prosecutor\'s fallacy c. n
a. cDNA 1) proteomics b. phylogenetic conservation 2) prosecutor's fallacy c. nonfunctional duplicate 3) MALDI-TOF d. DNA probe 4) transcriptomics e. isoelectric focusing 5) genom…
a. cysteine protease b. metalloprotease c. threonine protease d. serine protease
a. cysteine protease b. metalloprotease c. threonine protease d. serine protease e. aspartic protease Match the each following protein tags to their purification mechanism. "Strep…
a. drink more than 4 alcoholic beverages per day b. have undergone bariatric sur
a. drink more than 4 alcoholic beverages per day b. have undergone bariatric surgery c. are carrying triplets d. have gestational diabetes e. are at risk for preeclampsia 1 points…
a. ethanol b. acetonitrile c. dimethylformamide d. acetone Which of the followin
a. ethanol b. acetonitrile c. dimethylformamide d. acetone Which of the following alkyl halides reacts most rapidly via an SN1 solvolysis reaction in hot methanol? 8. a. 1-iodohex…
a. in drosophila\'s autosomal gene T there are two alleles: T and t. when the re
a. in drosophila's autosomal gene T there are two alleles: T and t. when the reccecive t allele is homozygous, it turns female drosophila (XX) into male (phenotypeically only). al…
a. in humans, there are several genetic isotopes for antibodies and collagen. wh
a. in humans, there are several genetic isotopes for antibodies and collagen. what genetic mechanism explains the appearance of multiple gene copies in the human genome(pick the b…
a. is usually a carbu supplies energy to start a chemical reaciu is specific to
a. is usually a carbu supplies energy to start a chemical reaciu is specific to one chemical reaction is consumed each time it is used raises the energy barrier for a chemical rea…
a. main difference between arteries and arterioles is that iolar walls contain m
a. main difference between arteries and arterioles is that iolar walls contain more muscle than arterial walls Arteries are than d. Rela ve to their d arterial walls are thicker t…
a. nondisjunction during meiosis b. c. d an inversion a chromosomal deletion X-l
a. nondisjunction during meiosis b. c. d an inversion a chromosomal deletion X-linked dominance 22. What is nondisjunction? a. failure of chromosomes to duplicate before mitosis o…
a. pH must be at least 2 b. pancreatic juice must be secreted c. bile must be pr
a. pH must be at least 2 b. pancreatic juice must be secreted c. bile must be present d. pancreatic juice must be secreted and bile must be present Which reaction is aided by a pH…
Subject
Biology and Genetics
Use Browse or pick another subject.