Biology and Genetics
101624 questions • Page 1838 / 2033
You have made magnetic field measurements near some lavas at 60N, 90W. The incli
You have made magnetic field measurements near some lavas at 60N, 90W. The inclination of the lava’s magnetization is 24 degrees. a)Suppose the lavas were not tilted after cooling…
You have managed to isolate and partially sequence a protein that you think is i
You have managed to isolate and partially sequence a protein that you think is involved in making cancer cells immortal: PPTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAKTGSEMKLT…
You have modified the green fluorescent protein (GFP) to carry a nuclear localiz
You have modified the green fluorescent protein (GFP) to carry a nuclear localization signal at its N-terminus and a nuclear export signal at its C-terminus. When this protein is …
You have mutated some nice and found a dominant mutation that cause diabetes (D)
You have mutated some nice and found a dominant mutation that cause diabetes (D) in mice. You are trying to map the mutation. You have mice that have 2 separate recessive mouse ey…
You have noticed an increase in CVO2 in a critically ill patient. His CaO2 has n
You have noticed an increase in CVO2 in a critically ill patient. His CaO2 has not changed from the previous value. Which one of the following is the most likely explanation for t…
You have now read about Beethoven and have listened to a few of his major works.
You have now read about Beethoven and have listened to a few of his major works. Admittedly, if this is your first exposure to Western “classical music”, it might all seem very st…
You have now read the entire play, Hedda Gabler. Now re-read Act 1 and write a 1
You have now read the entire play, Hedda Gabler. Now re-read Act 1 and write a 1200-word (3+ pages, double-spaced) discussion of what we learn from Act I that will determine the c…
You have now read the entire play, Hedda Gabler. Now re-read Act I and write a 1
You have now read the entire play, Hedda Gabler. Now re-read Act I and write a 1200-word (3+ pages, double-spaced) discussion of what we learn from Act I that will determine the c…
You have now read the entire play, Hedda Gabler. Now re-read Act I and write a 1
You have now read the entire play, Hedda Gabler. Now re-read Act I and write a 1200-word (3+ pages, double-speed) discussion of what we learn from Act I that will determine the co…
You have now read the entire play. Hedda Gabler. Now re-read Act I and write a 1
You have now read the entire play. Hedda Gabler. Now re-read Act I and write a 1200-word (3+ pages, double-spaced) discussion of what we learn from act I that will determine the c…
You have observed (or heard) that your neighbor’s rooster crows every morning ju
You have observed (or heard) that your neighbor’s rooster crows every morning just before daylight. Not only are you tired of being woken up before dawn, you also would like to kn…
You have observed horizontal gene transfer among two closely related species of
You have observed horizontal gene transfer among two closely related species of Vibrio cholerae, the causative agent of cholera-Species A and Species B. Species A is resistant to …
You have obtained complete genome sequences of 100 individuals of teosinte plant
You have obtained complete genome sequences of 100 individuals of teosinte plants (the wild progenitor of maize) and 1(M) individuals of domesticated maize from Mexico (these are …
You have partially sequenced the protein from a kangaroo. The sequence is Leu Me
You have partially sequenced the protein from a kangaroo. The sequence is Leu Met Asp Cys Trp Ile Thr Phe Ile. You want to extract the corresponding gene from wombats which you be…
You have performed a litterbag experiment using a 10 g sample of pine needles in
You have performed a litterbag experiment using a 10 g sample of pine needles in a coniferous stand at Coweeta. At the end of 0.80 years, the dry mass of your sample is 8.5 g. Cal…
You have performed the following trihybrid test cross in maize with the colorles
You have performed the following trihybrid test cross in maize with the colorless (c), waxy (wx) and shrunken (sh) loci. You need to figure out the map order and distance between …
You have performed yeast two hybrid assay to identify proteins that interact wit
You have performed yeast two hybrid assay to identify proteins that interact with Superman and identified a gene coding for kryptonite that interacts with Superman. What experimen…
You have prepared 10 ?m diameter polystyrene microparticles densely coated with
You have prepared 10 ?m diameter polystyrene microparticles densely coated with casein (milk protein), whose isoelectric point, p1 = 4.6. The coated particles are dissolved in pur…
You have prepared a batch of competent E coli cells and found its transformation
You have prepared a batch of competent E coli cells and found its transformation efficiency is 10^6 per mu g plasmid DNA. A professional scientists prepared competent E coli cells…
You have prepared a cell suspension of mouse lymph node cells (10 ml total in yo
You have prepared a cell suspension of mouse lymph node cells (10 ml total in your tube) and now wish to determine the concentration of cells using a hemacytometer. You perform a …
You have prepared lipid micelles that possess a leaky Na+ion channel, and, for p
You have prepared lipid micelles that possess a leaky Na+ion channel, and, for purposes of experimentation, the cytosolic sides of the channels are facing outward. Predict what wi…
You have prepared lipid vesicles (spherical lipid bilayers) that contain Na + -K
You have prepared lipid vesicles (spherical lipid bilayers) that contain Na+-K+ pumps as the sole membrane protein. All of the Na+-K+ pumps are oriented in such a way that the por…
You have prepared lipid vesicles (spherical lipid bilayers) that contain Na+-K+
You have prepared lipid vesicles (spherical lipid bilayers) that contain Na+-K+ pumps as the sole membrane protein. All of the Na+-K+ pumps are oriented in such a way that the por…
You have prepared lipid vesicles (spherical lipid bilayers) that contain Na-K pu
You have prepared lipid vesicles (spherical lipid bilayers) that contain Na-K pumps as the sole membrane protein. All of the Nar-K pumps are oriented in sucha way that the portion…
You have prepared lipid vesicles (spherical lipid bilayers) that contain Na^+ -K
You have prepared lipid vesicles (spherical lipid bilayers) that contain Na^+ -K^+ pumps as the sole membrane protein. All of the Na^+ -K^+ pumps are oriented in such a way that t…
You have prepared lipid vesicles (spherical lipid bilayers) that contain Na^+ -K
You have prepared lipid vesicles (spherical lipid bilayers) that contain Na^+ -K^+ pumps as the sole membrane protein. All of the Na^+ -K^+ pumps are oriented in such a way that t…
You have prepared two culture tubes (tube A and lube B) containing thioglycolate
You have prepared two culture tubes (tube A and lube B) containing thioglycolate medium (FTM), which allows oxygen to diffuse only in the upper part of the medium. You inoculate t…
You have previously identified the gene LIV-1OO, that is expressed in liver cell
You have previously identified the gene LIV-1OO, that is expressed in liver cells. Your research advisor asks you to check whether LIV-1OO is expressed in any other tissues. You i…
You have probably noticed that some groups to which you have belonged were able
You have probably noticed that some groups to which you have belonged were able to get a task done very effectively, while other groups seemed to lack direction and purpose. When …
You have produced the protein Glacate intracellularly in E. coli, lysed cells an
You have produced the protein Glacate intracellularly in E. coli, lysed cells and clarified the solution which is now ready to be purified. The Glacate protein is relatively large…
You have purchased a heavily wooded 200 acre tract of land with the intention of
You have purchased a heavily wooded 200 acre tract of land with the intention of building 100 houses and a shopping center. The property is zoned for these uses. After purchasing …
You have purchased a protease that can specifically cleave the Gln-Gly peptide b
You have purchased a protease that can specifically cleave the Gln-Gly peptide bond of the GluAsp-Asp-Tyr –Asp-Gln-Gly sequence present in any protein (and it cleaves no other seq…
You have purified 50 ul of recombinant plasmid DNA from a small culture of bacte
You have purified 50 ul of recombinant plasmid DNA from a small culture of bacterial cells. You measure the absorbance of the sample using a spectrophotometer set at 260nm and 280…
You have purified 50 ul of recombinant plasmid DNA from a small culture of bacte
You have purified 50 ul of recombinant plasmid DNA from a small culture of bacterial cells. You measure the absorbance of the sample using a spectrophotometer set at 260nm and 280…
You have purified LDH using affinity chromatography. Using the Bradford assay, y
You have purified LDH using affinity chromatography. Using the Bradford assay, you determined the total protein concentration of the column fraction to be 7.5 mg/ml, in a final vo…
You have purified a protein (which you call protein X) that you suspect to be co
You have purified a protein (which you call protein X) that you suspect to be covalently modified by the addition of a single ubiquitin molecule. You also know that your purified …
You have purified a protein (which you call protein X) that you suspect to be co
You have purified a protein (which you call protein X) that you suspect to be covalently modified by the addition of a single ubiquitin molecule. You also know that your purified …
You have purified a protein (which you call protein X) that you suspect to be co
You have purified a protein (which you call protein X) that you suspect to be covalently modified by the addition of a single ubiquitin molecule. You also know that your purified …
You have purified a protein (which you call protein X) that you suspect to be co
You have purified a protein (which you call protein X) that you suspect to be covalently modified by the addition of a single ubiquitin molecule. You also know that your purified …
You have purified a protein from a bacterium Y that causes cells in tissue cultu
You have purified a protein from a bacterium Y that causes cells in tissue culture to increase their cAMP levels. You subsequently cloned a fragment of DNA from bacterium Y that c…
You have purified a protein, MT1, that binds only to GTP-bound tubulin. You proc
You have purified a protein, MT1, that binds only to GTP-bound tubulin. You proceed to fuse MT1 to GFP and find that the fusion of GFP to MT1 does not disrupt MT1 function in any …
You have purified a protein, MT1, that binds only to GTP-bound tubulin. You proc
You have purified a protein, MT1, that binds only to GTP-bound tubulin. You proceed to fuse MT1 to GFP and find that the fusion of GFP to MT1 does not disrupt MT1 function in any …
You have purified a protein, MT1, that binds only to GTP-bound tubulin. You proc
You have purified a protein, MT1, that binds only to GTP-bound tubulin. You proceed to fuse MT1 to GFP and find that the fusion of GFP to MT1 does not disrupt MT1 function in any …
You have purified protein you call MAP15. MAP 15 binds to tubulin that is GTP-bo
You have purified protein you call MAP15. MAP 15 binds to tubulin that is GTP-bound tubulin and does not bind to tubulin that is GDP-bound. You genetically engineered cells to exp…
You have purified three different pSPORT1 plasmids (pS1, pS2 and pS3) each with
You have purified three different pSPORT1 plasmids (pS1, pS2 and pS3) each with a different gene (A, B or C) cloned into it. You need to determine which plasmid has which gene. Yo…
You have purified three different pSPORT1 plasmids (pS1, pS2 and pS3) each with
You have purified three different pSPORT1 plasmids (pS1, pS2 and pS3) each with a different gene (A, B or C) cloned into it. You need to determine which plasmid has which gene. Yo…
You have purified total RNA from leaf cells of a maple tree. You dissolved all t
You have purified total RNA from leaf cells of a maple tree. You dissolved all the RNA in 50 ul (microliters) of pure water to make an "RNA Sample." You need to determine the conc…
You have purified total double-stranded DNA from Varicella Zoster. The purified
You have purified total double-stranded DNA from Varicella Zoster. The purified DNA was dissolved in TE (Tris-EDTA) buffer to make a total volume of 100 microliters to form the "O…
You have raised a specific, high - affinity monoclonal antibody against an enzym
You have raised a specific, high - affinity monoclonal antibody against an enzyme you are working on for you senior thesis. You further have identified that the antibody binds a s…
You have raised a specific, high-affinity monoclonal antibody against an enzyme
You have raised a specific, high-affinity monoclonal antibody against an enzyme you are working on, and have identified its interaction site as a stretch of six amino acids in the…
Subject
Biology and Genetics
Use Browse or pick another subject.