Biology and Genetics
101624 questions • Page 1842 / 2033
You measure levels of Ca2+ in various locations within a motor neuron
You measure levels of Ca<sup>2+</sup> in various locations within a motor neuron and a skeletal muscle fiber when the motor neuron is depolarized, and the muscle fiber…
You measure levels of Ca2+ in various locations within a motor neuron
You measure levels of Ca<sup>2+</sup> in various locations within a motor neuron and a skeletal muscle fiber when the motor neuron is depolarized, and the muscle fiber…
You measure levels of Ca2+ in various locations within a motor neuron
You measure levels of Ca<sup>2+</sup> in various locations within a motor neuron and a skeletal muscle fiber when the motor neuron is depolarized, and the muscle fiber…
You measure levels of Ca2+ in various locations within a motor neuron
You measure levels of Ca<sup>2+</sup> in various locations within a motor neuron and a skeletal muscle fiber when the motor neuron is depolarized, and the muscle fiber…
You measure the OD600 of your culture of chloramphenicol-treated XL1-Blue/pTrc99
You measure the OD600 of your culture of chloramphenicol-treated XL1-Blue/pTrc99A cells as described in Step 1 of Experiment 3A and obtain a value of 0.376. Assuming a plasmid cop…
You measure the concentration of DNA in a preparation of nucleic acid using a di
You measure the concentration of DNA in a preparation of nucleic acid using a diphenylamine assay. You also measure the absorbance of the preparation at 260 nm. Another assay indi…
You measure the following heats of reaction at 298 K Ca (s) + 2H + (aq) ------>
You measure the following heats of reaction at 298 K Ca (s) + 2H+ (aq) ------> Ca2+ (aq) +H2(g) H= -543 Kj/mol CaCO3 (s) + 2H+ (aq) ----->Ca2…
You measure the internal temperature of an animal and find it’s 5 degrees cooler
You measure the internal temperature of an animal and find it’s 5 degrees cooler than the current outside air temperature. You know nothing about the behavior or habitat use of th…
You measure the relative humidity at ground level at 25%. You find the temperatu
You measure the relative humidity at ground level at 25%. You find the temperature at ground level is 30 degrees C. Answer the following: a. What is the water vapor content of the…
You measure the relative humidity at ground level at 25%. You find the temperatu
You measure the relative humidity at ground level at 25%. You find the temperature at ground level is 30 degrees C. Answer the following: a. What is the water vapor content of the…
You measure the water potential of the cell and find it to be -3.6 kPa. The pres
You measure the water potential of the cell and find it to be -3.6 kPa. The pressure potential of the same cell is 0.46 kPa. If the cell were placed in a beaker with a solute pote…
You measure xylem pressure in two plants using the pressure chamber. In one, you
You measure xylem pressure in two plants using the pressure chamber. In one, you apply 10 bars of pressure before you notice water coming from the xylem of your sample. In the oth…
You measured the depth to ground water in two monirtoring wells, each at a diffe
You measured the depth to ground water in two monirtoring wells, each at a different location, and seperated by a distance of 1289 meters. The ground surface elevation at well A i…
You meet Mr. Devon Jones who is a 40-year-old African American male with a long-
You meet Mr. Devon Jones who is a 40-year-old African American male with a long-standing history of uncontrolled hypertension. Both of his parents died from hypertension and his m…
You meet Mr. Devon Jones who is a 40-year-old African American male with a long-
You meet Mr. Devon Jones who is a 40-year-old African American male with a long-standing history of uncontrolled hypertension. Both of his parents died from hypertension and his m…
You might not consider the Midwest when someone mentions a trip to the beach, bu
You might not consider the Midwest when someone mentions a trip to the beach, but the Lake of the Ozarks is a hotspot in the United States. Centrally located in the heart of Misso…
You must 25.0 mL of 0.234 M FeCl 3 with 42.5 mL of0.453 M NaOH. (a) What mass of
You must 25.0 mL of 0.234 M FeCl3 with 42.5 mL of0.453 M NaOH. (a) What mass ofFe(OH)3 (in grams) will precipitate from this reactionmixture? (b) One of the reactants(Fe…
You must cleave the following peptide into smaller fragments. LARYNMTQGRCKPVNTFV
You must cleave the following peptide into smaller fragments. LARYNMTQGRCKPVNTFVMHEPLVDVQNVCFKEAAAK How many peptides you can expect if you cleave the polypeptide with: A) Trypsin…
You must cleave the following peptide into smaller fragments. Larynmtqgrckpvntfv
You must cleave the following peptide into smaller fragments. Larynmtqgrckpvntfvmhepl Vdvqnvcfkeaaak expect to find: E) How many different possible arrangements of disulfide bonds…
You must include both in-text citation 2. List 3 of the major female association
You must include both in-text citation 2. List 3 of the major female associations of the Progressive Era and describe the goals and activities of each organization. Explain what i…
You must include both in-text citations and a works cited page and cite all info
You must include both in-text citations and a works cited page and cite all information taken from a source, including information that is paraphrased. 3. What rights were demande…
You must provide complete citations in APA format (you don’t need to double spac
You must provide complete citations in APA format (you don’t need to double space) for the sources of information you used to support your answers for the questions in Part B. If …
You must quickly determine the porosity of the soil on-site without taking it to
You must quickly determine the porosity of the soil on-site without taking it to the lab. You extract a soil core within the contaminated region. The sample tube which contains th…
You must read article in this link in order to asnswer questions: Copy and paste
You must read article in this link in order to asnswer questions: Copy and paste link into your browser http://journals.plos.org/plosone/article?id=10.1371/journal.pone.0086046 QU…
You must set up a bomb calorimetry experiment using 1 Liter ofwater as your heat
You must set up a bomb calorimetry experiment using 1 Liter ofwater as your heat sink and combusting a 4.409g sample of propane(C3H8). If the initial and final temperature are 24.…
You must use the full name, no abbreviations. Name the dynamic found around the
You must use the full name, no abbreviations. Name the dynamic found around the cell. You will find this on the outside of a bacterium or a plant cell, but you will never find thi…
You mutated the DNA polymerae I gene so that it is temperature sensitive and the
You mutated the DNA polymerae I gene so that it is temperature sensitive and therefore inactivated with temperatures higher than 42 degrees celsius. You grew E. coli in 3H medium …
You need a strong acid for an experiment, and you are given a bottle that you ar
You need a strong acid for an experiment, and you are given a bottle that you are told contains a strong acid at 15.0 M concentration. (The name of the acid on the label was rubbe…
You need to amplify a specific DNA sequence from a dried drop of blood at a crim
You need to amplify a specific DNA sequence from a dried drop of blood at a crime scene. A forensic hematologist informs you that there are approximately 1000 white blood cells an…
You need to an L.PN starting a morning shift at a long-term care with 25 residen
You need to an L.PN starting a morning shift at a long-term care with 25 residents. prioritize, for there are 4 patients needing your immediate attention. Patient A needs pain med…
You need to determine if the number you observed in each category is significant
You need to determine if the number you observed in each category is significantly different from the number you expected if the null hypothesis is the best explanation. What is t…
You need to determine which degradable material to use as a tissue engineering s
You need to determine which degradable material to use as a tissue engineering scaffold for repair of a critical- sized bone defect (i.e. a defect that would not heal on its own).…
You need to determine which degradable material to use as a tissue engineering s
You need to determine which degradable material to use as a tissue engineering scaffold for repair of a critical-sized bone defect. (A critical-size defect is one that would not h…
You need to determine which degradable material to use as a tissue engineering s
You need to determine which degradable material to use as a tissue engineering scaffold for repair of a critical-sized bone defect. (A critical-size defect is one that would not h…
You need to explain to your study group why the breathing ability of amniotes is
You need to explain to your study group why the breathing ability of amniotes is different than that of amphibians. Your classmates argue that something like a terrestrial salaman…
You need to explain to your study group why the breathing ability of amniotes is
You need to explain to your study group why the breathing ability of amniotes is different than that of amphibians. Your classmates argue that something like a terrestrial salaman…
You need to explain to your study group why the breathing ability of amniotes is
You need to explain to your study group why the breathing ability of amniotes is different than that of amphibians. Your classmates argue that something like a terrestrial salaman…
You need to express and purify a large amount of a protein for testing in an ani
You need to express and purify a large amount of a protein for testing in an animal trial. The protein is larger than average, though not excessive so (~100 kDa, so the transcript…
You need to prepare blood for a transfusion. You have the following three proces
You need to prepare blood for a transfusion. You have the following three processed blood packs available: Pack A – Enriched in red blood cells (RBCs) Contents: 2.5 wt% white bloo…
You need to prepare blood for a transfusion. You have the following three proces
You need to prepare blood for a transfusion. You have the following three processed blood packs available: Pack A- enriched in Red Blood Cells (RBCs) Contents: 2.5 wt% white blood…
You need to quantify expression of the INS gene on several stem cell derived ins
You need to quantify expression of the INS gene on several stem cell derived insulin- secreting cell products (SCb) that you have generated: SCb1, SCb2, SCb3, SCb4, SCb5, SCb7 and…
You need to use outside sources (i.e., Internet, journal articles, other texts,
You need to use outside sources (i.e., Internet, journal articles, other texts, etc.) to complete this assignment. Any additional research should be cited in APA format, and liste…
You next decide to demonstrate for yourself that cysteines in cytosolic proteins
You next decide to demonstrate for yourself that cysteines in cytosolic proteins are not involved in disulfide bonds while cysteines do participate in disulfide bonds in extracell…
You next examine the location of a different secreted protein called oxytocin us
You next examine the location of a different secreted protein called oxytocin using mmunofluorescence [same procedure as before, except this time you use an antibody that binds to…
You notice a farmer applying fertilizer on land adjacent to your favorite fishin
You notice a farmer applying fertilizer on land adjacent to your favorite fishing spot. The same day it rains. You decide to go fishing a few days later when the weather is nicer.…
You notice several bloodstains on the wall and ceiling behind the male and the c
You notice several bloodstains on the wall and ceiling behind the male and the chair. The male appears to have a large wound on the top of his head and the upper portion of his fo…
You notice that a girl on your cycling team has lost a lot of body fat since las
You notice that a girl on your cycling team has lost a lot of body fat since last season. On group rides you notice that her endurance has increased since last year and she is abl…
You notice that in most biology and genetics textbooks, the authors show that Gr
You notice that in most biology and genetics textbooks, the authors show that Gregor Mendel used flower color as one of his pairs of traits. The purple flower phenotype is dominan…
You notice that the shape and size of cells in roots differ quite a bit. a) Prim
You notice that the shape and size of cells in roots differ quite a bit. a) Primary cell walls are made mostly of ___________ (what polymer?) which is synthesized from units of___…
You notice that transfection of this cDNA in mammalian CHO cells results in tran
You notice that transfection of this cDNA in mammalian CHO cells results in transfected cells with a distinct shape. You are considering whether the transfected cDNA might affect …
Subject
Biology and Genetics
Use Browse or pick another subject.